PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 933aa    MW: 102275 Da    PI: 5.8829
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01461.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29585636152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Pahal.F01461.1 585 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 636
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.621575656IPR003035RWP-RK domain
PfamPF020423.3E-26588636IPR003035RWP-RK domain
SuperFamilySSF542774.91E-21828923No hitNo description
Gene3DG3DSA:3.10.20.2403.5E-25838919No hitNo description
PfamPF005641.3E-16838919IPR000270PB1 domain
PROSITE profilePS5174520.28838920IPR000270PB1 domain
SMARTSM006665.2E-26838920IPR000270PB1 domain
CDDcd064079.65E-34839919No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MDLDPPTSGP GDACAVSADA WPFDSLTTSL LFSSVSASPP LPPLPANSSS WLTPPSPLWL  60
FEDRHLLPLD APQAPEAAVA AAVVEEVQRA RSGNSDTTSK RVEQINHKWQ FHLSLDEDGT  120
DNSSLFKERL TQALRYFKDS TDQHLLVQVW APVKNGDRYV LTTSGQPFVL DHQSIGLLQY  180
RAVSMMYMFS VDGENVGELG LPGRVYKLKV PEWTPNVQYY SSTEYPRLNH AISYNVHGTV  240
ALPVFDPSAQ SCIAVVELIM TSKKINYACE VDKVCKALEA VNLKSTEILD HPNVQICNEG  300
RQTALVEILE ILTVVCEEHK LPLAQTWVPC KYRSVLAHGG GLKKSCLSFD GSCMGEVCMS  360
TSDVAFHVID AHMWGFRDAC VEHHLQRGQG VSGKAFITRK PCFSKDIRKF CKLKYPLVHY  420
ARMFGLAGCF AICLQSSYTG HDDYILEFFL PPDCIDEDDQ NALLESIFTL MKQCLRSLKV  480
VGDRDSSGVS LQLSNVLKIE NEEFKTDAQF DNSDGSLHES PEDGGAHTFD NGDNKVPNLP  540
EGHLMADDCS QDNGTSAGRP NGSGASDSLV LHKTSKPPER RRGKAEKTIS LEVLQQYFSG  600
SLKNAAKSLG VCPTTMKRIC RQHGISRWPS RKINKVNRSF SKLKQVIESV QGSDAAFNLT  660
SITGPLPIPV GPSSDSLNVE KVTQSKVAEP LNLVVDGDRD SSLQKSVEND GHFSILMAQQ  720
GFMDNNNDAQ LEADKASHSR SSSGEGSINS RTSEGSCQGS PANRTFVCKP IASTFAEPQL  780
NPEEFHKEPF QEPQLPLSRM LIEDSGSSKD LKNLFTPAAD QPFLAPPSNL VSMKHSGTVT  840
IKASFKEDIV RFRFPCSGSV TVLKDEVAKR LRMDVGTFDI KYLDDDHEWV KLACNADLEE  900
CMEISRSSGS HVIRLLVSDI TAHLGSSCGS SG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967359.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7